Recombinant Human RB1CC1 Protein (1241-1594 aa), His-Myc-tagged

• Cat.No.: RB1CC1-2673H
• Product Overview: Recombinant Human RB1CC1 Protein (1241-1594 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1241-1594 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 47.7 kDa
• AA Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RB1CC1 RB1-inducible coiled-coil 1 [ Homo sapiens ]
• Official Symbol: RB1CC1
• Synonyms: RB1CC1; RB1-inducible coiled-coil 1; RB1-inducible coiled-coil protein 1; Cc1; DRAGOU14; FIP200; KIAA0203; CC1
• Gene ID: 9821
• mRNA Refseq: NM_001083617
• Protein Refseq: NP_001077086
• MIM: 606837
• UniProt ID: Q8TDY2