Recombinant Human RBBP6, GST-tagged

• Cat.No.: RBBP6-2200H
• Product Overview: Recombinant Human RBBP6(1-118aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-118aa
• Tag: N-GST
• Form: Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% Mannitol
• Molecular Mass: The protein has a calculated MW of 39 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 80% as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.325mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSD-LVPRGS-MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAIDDSSASISLAQLTKTA

Gene Information

• Gene Name: RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ]
• Official Symbol: RBBP6
• Synonyms: RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423
• Gene ID: 5930
• mRNA Refseq: NM_006910
• Protein Refseq: NP_008841
• MIM: 600938
• UniProt ID: Q7Z6E9