Recombinant Human RBCK1 protein, His-tagged

Cat.No. : RBCK1-3522H
Product Overview : Recombinant Human RBCK1 protein(225-500 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 225-500 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : EERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name RBCK1 RanBP-type and C3HC4-type zinc finger containing 1 [ Homo sapiens ]
Official Symbol RBCK1
Synonyms RBCK1; RanBP-type and C3HC4-type zinc finger containing 1; C20orf18, chromosome 20 open reading frame 18; ranBP-type and C3HC4-type zinc finger-containing protein 1; RBCK2; RNF54; UBCE7IP3; XAP4; ZRANB4; RING finger protein 54; HBV associated factor 4; HBV-associated factor 4; RBCC protein interacting with PKC1; heme-oxidized IRP2 ubiquitin ligase 1; hepatitis B virus X-associated protein 4; ubiquitin conjugating enzyme 7 interacting protein 3; ubiquitin-conjugating enzyme 7-interacting protein 3; XAP3; HOIL1; HOIL-1; C20orf18;
Gene ID 10616
mRNA Refseq NM_006462
Protein Refseq NP_006453
MIM 610924
UniProt ID Q9BYM8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBCK1 Products

Required fields are marked with *

My Review for All RBCK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon