Recombinant Human RBCK1 protein, His-tagged

• Cat.No.: RBCK1-3522H
• Product Overview: Recombinant Human RBCK1 protein(225-500 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 225-500 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: EERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: RBCK1 RanBP-type and C3HC4-type zinc finger containing 1 [ Homo sapiens ]
• Official Symbol: RBCK1
• Synonyms: RBCK1; RanBP-type and C3HC4-type zinc finger containing 1; C20orf18, chromosome 20 open reading frame 18; ranBP-type and C3HC4-type zinc finger-containing protein 1; RBCK2; RNF54; UBCE7IP3; XAP4; ZRANB4; RING finger protein 54; HBV associated factor 4; HBV-associated factor 4; RBCC protein interacting with PKC1; heme-oxidized IRP2 ubiquitin ligase 1; hepatitis B virus X-associated protein 4; ubiquitin conjugating enzyme 7 interacting protein 3; ubiquitin-conjugating enzyme 7-interacting protein 3; XAP3; HOIL1; HOIL-1; C20orf18
• Gene ID: 10616
• mRNA Refseq: NM_006462
• Protein Refseq: NP_006453
• MIM: 610924
• UniProt ID: Q9BYM8