Recombinant Human RBL2 protein, His-tagged
| Cat.No. : | RBL2-4358H |
| Product Overview : | Recombinant Human RBL2 protein(Q08999)(417-616aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 417-616aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.4 kDa |
| AA Sequence : | TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RBL2 retinoblastoma-like 2 (p130) [ Homo sapiens ] |
| Official Symbol | RBL2 |
| Synonyms | RBL2; retinoblastoma-like 2 (p130); retinoblastoma-like protein 2; p130; Rb2; PRB2; RBR-2; retinoblastoma-related protein 2; 130 kDa retinoblastoma-associated protein; P130; FLJ26459; |
| Gene ID | 5934 |
| mRNA Refseq | NM_005611 |
| Protein Refseq | NP_005602 |
| MIM | 180203 |
| UniProt ID | Q08999 |
| ◆ Recombinant Proteins | ||
| RBL2-881H | Recombinant Human RBL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RBL2-2984C | Recombinant Chicken RBL2 | +Inquiry |
| RBL2-4955R | Recombinant Rat RBL2 Protein | +Inquiry |
| RBL2-6051HFL | Recombinant Full Length Human RBL2 protein, Flag-tagged | +Inquiry |
| Rbl2-5409M | Recombinant Mouse Rbl2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBL2-2483HCL | Recombinant Human RBL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBL2 Products
Required fields are marked with *
My Review for All RBL2 Products
Required fields are marked with *
