Recombinant Human RBM15B protein, His-tagged
| Cat.No. : | RBM15B-3765H |
| Product Overview : | Recombinant Human RBM15B protein(490-769 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 490-769 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RBM15B RNA binding motif protein 15B [ Homo sapiens ] |
| Official Symbol | RBM15B |
| Synonyms | RBM15B; RNA binding motif protein 15B; putative RNA-binding protein 15B; HUMAGCGB; OTT3; huOTT3; one twenty two protein 3; one-twenty two protein 3; RNA-binding motif protein 15B; chromosome 3p21.1 gene sequence; |
| Gene ID | 29890 |
| mRNA Refseq | NM_013286 |
| Protein Refseq | NP_037418 |
| MIM | 612602 |
| UniProt ID | Q8NDT2 |
| ◆ Recombinant Proteins | ||
| RBM15B-027H | Recombinant Human RNA binding motif protein 15B Protein, His&Flag&StrepII tagged | +Inquiry |
| RBM15B-7470M | Recombinant Mouse RBM15B Protein, His (Fc)-Avi-tagged | +Inquiry |
| RBM15B-3628R | Recombinant Rhesus Macaque RBM15B Protein, His (Fc)-Avi-tagged | +Inquiry |
| RBM15B-3811R | Recombinant Rhesus monkey RBM15B Protein, His-tagged | +Inquiry |
| RBM15B-13992M | Recombinant Mouse RBM15B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBM15B-530HCL | Recombinant Human RBM15B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM15B Products
Required fields are marked with *
My Review for All RBM15B Products
Required fields are marked with *
