Recombinant Human RBM25 protein, GST-tagged
Cat.No. : | RBM25-2212H |
Product Overview : | Recombinant RBM25 protein, fused to GST-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 235 |
Description : | RNA-binding protein that acts as a regulator of alternative pre-mRNA splicing. Involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression. Modulates the ratio of proapoptotic BCL2L1 isoform S to antiapoptotic BCL2L1 isoform L mRNA expression. When overexpressed, stimulates proapoptotic BCL2L1 isoform S 5'-splice site (5'-ss) selection, whereas its depletion caused the accumulation of antiapoptotic BCL2L1 isoform L. Promotes BCL2L1 isoform S 5'-ss usage through the 5'-CGGGCA-3' RNA sequence. Its association with LUC7L3 promotes U1 snRNP binding to a weak 5' ss in a 5'-CGGGCA-3'-dependent manner. Binds to the exonic splicing enhancer 5'-CGGGCA-3' RNA sequence located within exon 2 of the BCL2L1 pre-mRNA. Also involved in the generation of an abnormal and truncated splice form of SCN5A in heart failure. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 52 kDa |
AA Sequence : | LKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). |
Gene Name | RBM25 |
Official Symbol | RBM25 |
Synonyms | S164; NET52; RNPC7; Snu71; RED120; fSAP94 |
Gene ID | 58517 |
mRNA Refseq | NM_021239.3 |
Protein Refseq | NP_067062.1 |
MIM | 612427 |
UniProt ID | P49756 |
◆ Recombinant Proteins | ||
RBM25-2212H | Recombinant Human RBM25 protein, GST-tagged | +Inquiry |
RBM25-2211H | Recombinant Human RBM25, His-tagged | +Inquiry |
RBM25-7475M | Recombinant Mouse RBM25 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM25-4456C | Recombinant Chicken RBM25 | +Inquiry |
RBM25-10178Z | Recombinant Zebrafish RBM25 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM25 Products
Required fields are marked with *
My Review for All RBM25 Products
Required fields are marked with *