Recombinant Human RBM4, GST-tagged
| Cat.No. : | RBM4-105H |
| Product Overview : | Recombinant Human RBM4 (1 a.a. - 364 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RNA-binding protein 4 is a protein that in humans is encoded by the RBM4 gene. |
| Molecular Mass : | 65.78 kDa |
| AA Sequence : | MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSK TSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRL RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRC RAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRARYSAF |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RBM4 RNA binding motif protein 4 [ Homo sapiens (human) ] |
| Official Symbol | RBM4 |
| Synonyms | RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21; RP11-658F2.8; RNA binding motif protein 4; RNA-binding protein 4; lark homolog; RNA-binding motif protein 4a; transcriptional coactivator CoAZ; zinc finger CCHC-type and RNA binding motif 3A |
| Gene ID | 5936 |
| mRNA Refseq | NM_001198843 |
| Protein Refseq | NP_001185772 |
| MIM | 602571 |
| UniProt ID | Q9BWF3 |
| Chromosome Location | 11q13 |
| Function | RNA binding; mRNA 3'-UTR binding; poly(A) RNA binding |
| ◆ Recombinant Proteins | ||
| RBM4-847C | Recombinant Cynomolgus RBM4 Protein, His-tagged | +Inquiry |
| Rbm4-5413M | Recombinant Mouse Rbm4 Protein, Myc/DDK-tagged | +Inquiry |
| RBM4-655H | Recombinant Human RBM4 Protein, MYC/DDK-tagged | +Inquiry |
| RBM4-430HF | Recombinant Full Length Human RBM4 Protein, GST-tagged | +Inquiry |
| RBM4-31230TH | Recombinant Full Length Human RBM4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBM4-531HCL | Recombinant Human RBM4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM4 Products
Required fields are marked with *
My Review for All RBM4 Products
Required fields are marked with *
