Recombinant Human RBM4, GST-tagged

Cat.No. : RBM4-105H
Product Overview : Recombinant Human RBM4 (1 a.a. - 364 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNA-binding protein 4 is a protein that in humans is encoded by the RBM4 gene.
Molecular Mass : 65.78 kDa
AA Sequence : MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSK TSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRL RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRC RAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRARYSAF
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RBM4 RNA binding motif protein 4 [ Homo sapiens (human) ]
Official Symbol RBM4
Synonyms RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21; RP11-658F2.8; RNA binding motif protein 4; RNA-binding protein 4; lark homolog; RNA-binding motif protein 4a; transcriptional coactivator CoAZ; zinc finger CCHC-type and RNA binding motif 3A
Gene ID 5936
mRNA Refseq NM_001198843
Protein Refseq NP_001185772
MIM 602571
UniProt ID Q9BWF3
Chromosome Location 11q13
Function RNA binding; mRNA 3'-UTR binding; poly(A) RNA binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM4 Products

Required fields are marked with *

My Review for All RBM4 Products

Required fields are marked with *

0
cart-icon