Recombinant Human RBM4, GST-tagged
Cat.No. : | RBM4-105H |
Product Overview : | Recombinant Human RBM4 (1 a.a. - 364 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | RNA-binding protein 4 is a protein that in humans is encoded by the RBM4 gene. |
Molecular Mass : | 65.78 kDa |
AA Sequence : | MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSK TSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRL RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRC RAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRARYSAF |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RBM4 RNA binding motif protein 4 [ Homo sapiens (human) ] |
Official Symbol | RBM4 |
Synonyms | RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21; RP11-658F2.8; RNA binding motif protein 4; RNA-binding protein 4; lark homolog; RNA-binding motif protein 4a; transcriptional coactivator CoAZ; zinc finger CCHC-type and RNA binding motif 3A |
Gene ID | 5936 |
mRNA Refseq | NM_001198843 |
Protein Refseq | NP_001185772 |
MIM | 602571 |
UniProt ID | Q9BWF3 |
Chromosome Location | 11q13 |
Function | RNA binding; mRNA 3'-UTR binding; poly(A) RNA binding |
◆ Recombinant Proteins | ||
RBM4-31230TH | Recombinant Full Length Human RBM4, His-tagged | +Inquiry |
RBM4-2490H | Recombinant Human RBM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBM4-590C | Recombinant Cynomolgus Monkey RBM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM4-847C | Recombinant Cynomolgus RBM4 Protein, His-tagged | +Inquiry |
Rbm4-5413M | Recombinant Mouse Rbm4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM4-531HCL | Recombinant Human RBM4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM4 Products
Required fields are marked with *
My Review for All RBM4 Products
Required fields are marked with *