Recombinant Human RBM7 Protein, His-tagged
Cat.No. : | RBM7-30931TH |
Product Overview : | Recombinant Human RBM7 Protein(5-266 aa), fused with a His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 5-266 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RBM7 RNA binding motif protein 7 [ Homo sapiens ] |
Official Symbol | RBM7 |
Synonyms | RBM7; RNA binding motif protein 7; RNA-binding protein 7 |
Gene ID | 10179 |
mRNA Refseq | NM_016090 |
Protein Refseq | NP_057174 |
MIM | 612413 |
UniProt ID | Q9Y580 |
◆ Recombinant Proteins | ||
RBM7-30931TH | Recombinant Human RBM7 Protein, His-tagged | +Inquiry |
RBM7-1463C | Recombinant Chicken RBM7 | +Inquiry |
RBM7-3823R | Recombinant Rhesus monkey RBM7 Protein, His-tagged | +Inquiry |
RBM7-3640R | Recombinant Rhesus Macaque RBM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM7 Products
Required fields are marked with *
My Review for All RBM7 Products
Required fields are marked with *
0
Inquiry Basket