Recombinant Human RBMX protein(11-90 aa), C-His-tagged
| Cat.No. : | RBMX-2745H |
| Product Overview : | Recombinant Human RBMX protein(P38159)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-90 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE |
| Gene Name | RBMX RNA binding motif protein, X-linked [ Homo sapiens ] |
| Official Symbol | RBMX |
| Synonyms | RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G; |
| Gene ID | 27316 |
| mRNA Refseq | NM_001164803 |
| Protein Refseq | NP_001158275 |
| MIM | 300199 |
| UniProt ID | P38159 |
| ◆ Recombinant Proteins | ||
| RBMX-4626R | Recombinant Rat RBMX Protein, His (Fc)-Avi-tagged | +Inquiry |
| RBMX-3561C | Recombinant Chicken RBMX | +Inquiry |
| RBMX-11877Z | Recombinant Zebrafish RBMX | +Inquiry |
| RBMX-848C | Recombinant Cynomolgus RBMX Protein, His-tagged | +Inquiry |
| RBMX-4967R | Recombinant Rat RBMX Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBMX Products
Required fields are marked with *
My Review for All RBMX Products
Required fields are marked with *
