Recombinant Human RBMX protein(11-90 aa), C-His-tagged

Cat.No. : RBMX-2745H
Product Overview : Recombinant Human RBMX protein(P38159)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-90 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Gene Name RBMX RNA binding motif protein, X-linked [ Homo sapiens ]
Official Symbol RBMX
Synonyms RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G;
Gene ID 27316
mRNA Refseq NM_001164803
Protein Refseq NP_001158275
MIM 300199
UniProt ID P38159

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBMX Products

Required fields are marked with *

My Review for All RBMX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon