Recombinant Human RBMX protein(11-90 aa), C-His-tagged
Cat.No. : | RBMX-2745H |
Product Overview : | Recombinant Human RBMX protein(P38159)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-90 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE |
Gene Name | RBMX RNA binding motif protein, X-linked [ Homo sapiens ] |
Official Symbol | RBMX |
Synonyms | RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G; |
Gene ID | 27316 |
mRNA Refseq | NM_001164803 |
Protein Refseq | NP_001158275 |
MIM | 300199 |
UniProt ID | P38159 |
◆ Recombinant Proteins | ||
RBMX-591C | Recombinant Cynomolgus Monkey RBMX Protein, His (Fc)-Avi-tagged | +Inquiry |
RBMX-2745H | Recombinant Human RBMX protein(11-90 aa), C-His-tagged | +Inquiry |
RBMX-2220H | Recombinant Human RBMX, GST-tagged | +Inquiry |
RBMX-3414H | Recombinant Human RBMX protein, GST-tagged | +Inquiry |
RBMX-4967R | Recombinant Rat RBMX Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBMX Products
Required fields are marked with *
My Review for All RBMX Products
Required fields are marked with *