Recombinant Human RBMX protein, GST-tagged
Cat.No. : | RBMX-3414H |
Product Overview : | Recombinant Human RBMX protein(P38159)(333-391aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 333-391aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RBMX RNA binding motif protein, X-linked [ Homo sapiens ] |
Official Symbol | RBMX |
Synonyms | RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G; |
Gene ID | 27316 |
mRNA Refseq | NM_001164803 |
Protein Refseq | NP_001158275 |
MIM | 300199 |
UniProt ID | P38159 |
◆ Recombinant Proteins | ||
RBMX-848C | Recombinant Cynomolgus RBMX Protein, His-tagged | +Inquiry |
RBMX-4967R | Recombinant Rat RBMX Protein | +Inquiry |
RBMX-2220H | Recombinant Human RBMX, GST-tagged | +Inquiry |
RBMX-591C | Recombinant Cynomolgus Monkey RBMX Protein, His (Fc)-Avi-tagged | +Inquiry |
RBMX-3414H | Recombinant Human RBMX protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBMX Products
Required fields are marked with *
My Review for All RBMX Products
Required fields are marked with *
0
Inquiry Basket