Recombinant Human RBMX protein, GST-tagged
| Cat.No. : | RBMX-3414H |
| Product Overview : | Recombinant Human RBMX protein(P38159)(333-391aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 333-391aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.4 kDa |
| AA Sequence : | DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RBMX RNA binding motif protein, X-linked [ Homo sapiens ] |
| Official Symbol | RBMX |
| Synonyms | RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G; |
| Gene ID | 27316 |
| mRNA Refseq | NM_001164803 |
| Protein Refseq | NP_001158275 |
| MIM | 300199 |
| UniProt ID | P38159 |
| ◆ Recombinant Proteins | ||
| RBMX-4967R | Recombinant Rat RBMX Protein | +Inquiry |
| RBMX-2745H | Recombinant Human RBMX protein(11-90 aa), C-His-tagged | +Inquiry |
| RBMX-4626R | Recombinant Rat RBMX Protein, His (Fc)-Avi-tagged | +Inquiry |
| RBMX-11877Z | Recombinant Zebrafish RBMX | +Inquiry |
| RBMX-848C | Recombinant Cynomolgus RBMX Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBMX Products
Required fields are marked with *
My Review for All RBMX Products
Required fields are marked with *
