Recombinant Human RBP1
Cat.No. : | RBP1-30075TH |
Product Overview : | Recombinant full length Human RBP1 with N-terminal proprietary tag.Mol Wt 40.92 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 135 amino acids |
Description : | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 40.920kDa inclusive of tags |
Tissue specificity : | Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ |
Sequence Similarities : | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
Gene Name | RBP1 retinol binding protein 1, cellular [ Homo sapiens ] |
Official Symbol | RBP1 |
Synonyms | RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC; |
Gene ID | 5947 |
mRNA Refseq | NM_001130992 |
Protein Refseq | NP_001124464 |
MIM | 180260 |
Uniprot ID | P09455 |
Chromosome Location | 3q21-q23 |
Pathway | Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem; |
Function | lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity; |
◆ Recombinant Proteins | ||
RBP1-2222H | Recombinant Human RBP1, His-tagged | +Inquiry |
RBP1-4970R | Recombinant Rat RBP1 Protein | +Inquiry |
RBP1-830H | Recombinant Human RBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBP1-30007TH | Recombinant Human RBP1, His-tagged | +Inquiry |
RBP1-329HFL | Active Recombinant Full Length Human RBP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP1-2457HCL | Recombinant Human RBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP1 Products
Required fields are marked with *
My Review for All RBP1 Products
Required fields are marked with *
0
Inquiry Basket