Recombinant Human RBP1

Cat.No. : RBP1-30075TH
Product Overview : Recombinant full length Human RBP1 with N-terminal proprietary tag.Mol Wt 40.92 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 135 amino acids
Description : This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 40.920kDa inclusive of tags
Tissue specificity : Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ
Sequence Similarities : Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Gene Name RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
Official Symbol RBP1
Synonyms RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC;
Gene ID 5947
mRNA Refseq NM_001130992
Protein Refseq NP_001124464
MIM 180260
Uniprot ID P09455
Chromosome Location 3q21-q23
Pathway Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem;
Function lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBP1 Products

Required fields are marked with *

My Review for All RBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon