Recombinant Human RBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBP1-830H
Product Overview : RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 15.7 kDa
AA Sequence : MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBP1 retinol binding protein 1 [ Homo sapiens (human) ]
Official Symbol RBP1
Synonyms RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular; CRABP-I;
Gene ID 5947
mRNA Refseq NM_002899
Protein Refseq NP_002890
MIM 180260
UniProt ID P09455

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBP1 Products

Required fields are marked with *

My Review for All RBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon