Recombinant Human RBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RBP1-830H
• Product Overview: RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 15.7 kDa
• AA Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RBP1 retinol binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: RBP1
• Synonyms: RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular; CRABP-I
• Gene ID: 5947
• mRNA Refseq: NM_002899
• Protein Refseq: NP_002890
• MIM: 180260
• UniProt ID: P09455