Recombinant Human RBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RBP1-830H |
Product Overview : | RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 15.7 kDa |
AA Sequence : | MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RBP1 retinol binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | RBP1 |
Synonyms | RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular; CRABP-I; |
Gene ID | 5947 |
mRNA Refseq | NM_002899 |
Protein Refseq | NP_002890 |
MIM | 180260 |
UniProt ID | P09455 |
◆ Recombinant Proteins | ||
RBP1-30007TH | Recombinant Human RBP1, His-tagged | +Inquiry |
RBP1-12152Z | Recombinant Zebrafish RBP1 | +Inquiry |
RBP1-2220H | Recombinant Human RBP1 protein | +Inquiry |
RBP1-6154H | Recombinant Human RBP1 Protein (Asp64-Gln135), N-His tagged | +Inquiry |
RBP1-30075TH | Recombinant Human RBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP1-2457HCL | Recombinant Human RBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP1 Products
Required fields are marked with *
My Review for All RBP1 Products
Required fields are marked with *