Recombinant Human RBP2
| Cat.No. : | RBP2-30008TH |
| Product Overview : | Recombinant fragment of Human RBP2 with N-terminal proprietary tag.Mol wt 35.53 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Tissue specificity : | Higher expression in adult small intestine and to a much lesser extent in fetal kidney. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK |
| Sequence Similarities : | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Gene Name | RBP2 retinol binding protein 2, cellular [ Homo sapiens ] |
| Official Symbol | RBP2 |
| Synonyms | RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2; |
| Gene ID | 5948 |
| mRNA Refseq | NM_004164 |
| Protein Refseq | NP_004155 |
| MIM | 180280 |
| Uniprot ID | P50120 |
| Chromosome Location | 3q23 |
| Pathway | Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Regulation of retinoblastoma protein, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem; Vitamin A uptake in enterocytes, organism-specific biosystem; |
| Function | lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity; |
| ◆ Recombinant Proteins | ||
| RBP2-4821C | Recombinant Chicken RBP2 | +Inquiry |
| RBP2-542P | Recombinant Pig RBP2 Protein, His-tagged | +Inquiry |
| RBP2-1523H | Recombinant Human RBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RBP2-3415H | Recombinant Human RBP2 protein, GST-tagged | +Inquiry |
| RBP2-535H | Recombinant Human RBP2 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBP2-533HCL | Recombinant Human RBP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP2 Products
Required fields are marked with *
My Review for All RBP2 Products
Required fields are marked with *
