Recombinant Human RBP3

Cat.No. : RBP3-30611TH
Product Overview : Recombinant fragment of Human RBP3 with an N-terminal proprietary tag; Predicted MW 36.41 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5 kbp in length and consists of four exons separated by three introns. The introns are 1.6-1.9 kbp long. The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da. The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events. In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected. The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long. The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively.
Molecular Weight : 36.410kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
Sequence Similarities : Belongs to the peptidase S41A family.
Gene Name RBP3 retinol binding protein 3, interstitial [ Homo sapiens ]
Official Symbol RBP3
Synonyms RBP3; retinol binding protein 3, interstitial; retinol-binding protein 3; D10S64; D10S65; D10S66;
Gene ID 5949
mRNA Refseq NM_002900
Protein Refseq NP_002891
MIM 180290
Uniprot ID P10745
Chromosome Location 10q11.2
Function retinal binding; retinoid binding; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBP3 Products

Required fields are marked with *

My Review for All RBP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon