Recombinant Human RBP3
| Cat.No. : | RBP3-30611TH |
| Product Overview : | Recombinant fragment of Human RBP3 with an N-terminal proprietary tag; Predicted MW 36.41 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5 kbp in length and consists of four exons separated by three introns. The introns are 1.6-1.9 kbp long. The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da. The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events. In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected. The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long. The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively. |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH |
| Sequence Similarities : | Belongs to the peptidase S41A family. |
| Gene Name | RBP3 retinol binding protein 3, interstitial [ Homo sapiens ] |
| Official Symbol | RBP3 |
| Synonyms | RBP3; retinol binding protein 3, interstitial; retinol-binding protein 3; D10S64; D10S65; D10S66; |
| Gene ID | 5949 |
| mRNA Refseq | NM_002900 |
| Protein Refseq | NP_002891 |
| MIM | 180290 |
| Uniprot ID | P10745 |
| Chromosome Location | 10q11.2 |
| Function | retinal binding; retinoid binding; serine-type peptidase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP3 Products
Required fields are marked with *
My Review for All RBP3 Products
Required fields are marked with *
