Recombinant Human RBP4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RBP4-781H |
| Product Overview : | RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. |
| Molecular Mass : | 23 kDa |
| AA Sequence : | MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RBP4 retinol binding protein 4 [ Homo sapiens (human) ] |
| Official Symbol | RBP4 |
| Synonyms | RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial; |
| Gene ID | 5950 |
| mRNA Refseq | NM_006744 |
| Protein Refseq | NP_006735 |
| MIM | 180250 |
| UniProt ID | P02753 |
| ◆ Recombinant Proteins | ||
| Rbp4-7427R | Active Recombinant Rat Rbp4 protein(Met1-Leu201), His-tagged | +Inquiry |
| RBP4-112C | Active Recombinant Cynomolgus RBP4, His tagged | +Inquiry |
| RBP4-52H | Recombinant Human RBP4 | +Inquiry |
| RBP4-442H | Recombinant Human RBP4 protein, His-tagged | +Inquiry |
| RBP4-46H | Recombinant Human RBP4 Protein, C-8His tagged, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
| RBP4-2271RCL | Recombinant Rat RBP4 cell lysate | +Inquiry |
| RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
| RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
| RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP4 Products
Required fields are marked with *
My Review for All RBP4 Products
Required fields are marked with *
