Recombinant Human RBP4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RBP4-781H
• Product Overview: RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
• Molecular Mass: 23 kDa
• AA Sequence: MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RBP4 retinol binding protein 4 [ Homo sapiens (human) ]
• Official Symbol: RBP4
• Synonyms: RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial
• Gene ID: 5950
• mRNA Refseq: NM_006744
• Protein Refseq: NP_006735
• MIM: 180250
• UniProt ID: P02753