Recombinant Human RCOR1 protein, GST-tagged

• Cat.No.: RCOR1-301383H
• Product Overview: Recombinant Human RCOR1 protein(245-310 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 245-310 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: RCOR1 REST corepressor 1 [ Homo sapiens ]
• Official Symbol: RCOR1
• Synonyms: RCOR1; REST corepressor 1; RCOR, REST corepressor; COREST; KIAA0071; RCOR
• Gene ID: 23186
• mRNA Refseq: NM_015156
• Protein Refseq: NP_055971
• MIM: 607675
• UniProt ID: Q9UKL0