Recombinant Human RCVRN Protein (2-200 aa), His-Myc-tagged

Cat.No. : RCVRN-2765H
Product Overview : Recombinant Human RCVRN Protein (2-200 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 2-200 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.0 kDa
AA Sequence : GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RCVRN recoverin [ Homo sapiens ]
Official Symbol RCVRN
Synonyms RCVRN; recoverin; RCV1; cancer associated retinopathy antigen; cancer-associated retinopathy protein;
Gene ID 5957
mRNA Refseq NM_002903
Protein Refseq NP_002894
MIM 179618
UniProt ID P35243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCVRN Products

Required fields are marked with *

My Review for All RCVRN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon