Recombinant Human RCVRN Protein (2-200 aa), His-Myc-tagged
Cat.No. : | RCVRN-2765H |
Product Overview : | Recombinant Human RCVRN Protein (2-200 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 2-200 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.0 kDa |
AA Sequence : | GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RCVRN recoverin [ Homo sapiens ] |
Official Symbol | RCVRN |
Synonyms | RCVRN; recoverin; RCV1; cancer associated retinopathy antigen; cancer-associated retinopathy protein; |
Gene ID | 5957 |
mRNA Refseq | NM_002903 |
Protein Refseq | NP_002894 |
MIM | 179618 |
UniProt ID | P35243 |
◆ Recombinant Proteins | ||
RCVRN-5057H | Recombinant Human RCVRN protein, His&Myc-tagged | +Inquiry |
RCVRN-3652R | Recombinant Rhesus Macaque RCVRN Protein, His (Fc)-Avi-tagged | +Inquiry |
RCVRN-3835R | Recombinant Rhesus monkey RCVRN Protein, His-tagged | +Inquiry |
RCVRN-2765H | Recombinant Human RCVRN Protein (2-200 aa), His-Myc-tagged | +Inquiry |
RCVRN-1847H | Recombinant Human RCVRN Protein (2-200 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCVRN-2442HCL | Recombinant Human RCVRN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCVRN Products
Required fields are marked with *
My Review for All RCVRN Products
Required fields are marked with *
0
Inquiry Basket