Recombinant Human RDBP, His-tagged
| Cat.No. : | RDBP-29223TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 63-380 of Human NELFe with a N terminal His tag; predicted MWt 37kDa: |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 63-380 a.a. |
| Description : | The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. |
| Conjugation : | HIS |
| Tissue specificity : | Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. |
| Form : | Lyophilised:reconstitution with 111 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKG PVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSS DRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHS SASPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDR DRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERR APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPP RNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARK QPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVY KENLVDGF |
| Sequence Similarities : | Belongs to the RRM NELF-E family.Contains 1 RRM (RNA recognition motif) domain. |
| Gene Name | RDBP RD RNA binding protein [ Homo sapiens ] |
| Official Symbol | RDBP |
| Synonyms | RDBP; RD RNA binding protein; negative elongation factor E; D6S45; NELF E; RD; RDP; |
| Gene ID | 7936 |
| mRNA Refseq | NM_002904 |
| Protein Refseq | NP_002895 |
| MIM | 154040 |
| Uniprot ID | P18615 |
| Chromosome Location | 6p21.3 |
| Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
| Function | RNA binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| RDBP-7505M | Recombinant Mouse RDBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| RDBP-2111H | Recombinant Human RDBP protein, GST-tagged | +Inquiry |
| RDBP-2235H | Recombinant Human RDBP protein, His-tagged | +Inquiry |
| RDBP-29223TH | Recombinant Human RDBP, His-tagged | +Inquiry |
| RDBP-3419H | Recombinant Human RD RNA Binding Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RDBP-2440HCL | Recombinant Human RDBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RDBP Products
Required fields are marked with *
My Review for All RDBP Products
Required fields are marked with *



