Recombinant Human RDBP, His-tagged
Cat.No. : | RDBP-29223TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 63-380 of Human NELFe with a N terminal His tag; predicted MWt 37kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 63-380 a.a. |
Description : | The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. |
Form : | Lyophilised:reconstitution with 111 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKG PVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSS DRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHS SASPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDR DRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERR APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPP RNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARK QPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVY KENLVDGF |
Sequence Similarities : | Belongs to the RRM NELF-E family.Contains 1 RRM (RNA recognition motif) domain. |
Gene Name | RDBP RD RNA binding protein [ Homo sapiens ] |
Official Symbol | RDBP |
Synonyms | RDBP; RD RNA binding protein; negative elongation factor E; D6S45; NELF E; RD; RDP; |
Gene ID | 7936 |
mRNA Refseq | NM_002904 |
Protein Refseq | NP_002895 |
MIM | 154040 |
Uniprot ID | P18615 |
Chromosome Location | 6p21.3 |
Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
Function | RNA binding; nucleotide binding; |
◆ Recombinant Proteins | ||
RDBP-29224TH | Recombinant Human RDBP, His-tagged | +Inquiry |
RDBP-2235H | Recombinant Human RDBP, His-tagged | +Inquiry |
RDBP-29223TH | Recombinant Human RDBP, His-tagged | +Inquiry |
RDBP-14043M | Recombinant Mouse RDBP Protein | +Inquiry |
RDBP-3419H | Recombinant Human RD RNA Binding Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDBP-2440HCL | Recombinant Human RDBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RDBP Products
Required fields are marked with *
My Review for All RDBP Products
Required fields are marked with *
0
Inquiry Basket