Recombinant Human RDRC protein, GST-tagged
| Cat.No. : | RDRC-2241H |
| Product Overview : | Recombinant Human RDRC (C-106aa) fussed with GST tag at N-terminal was expressed in E. coli. |
| Availability | January 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | C-106aa |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
| Molecular Mass : | 38 kDa |
| AA Sequence : | VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPL PLPTEEGNPLLKHYRGPAGDATVASEKESVM |
| Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | SLC1A5 solute carrier family 1 (neutral amino acid transporter), member 5 [ Homo sapiens ] |
| Official Symbol | SLC1A5 |
| Synonyms | SLC1A5; solute carrier family 1 (neutral amino acid transporter), member 5; M7V1, RDRC; neutral amino acid transporter B(0); AAAT; ASCT2; ATB(0); RD114 virus receptor; baboon M7 virus receptor; neutral amino acid transporter B; solute carrier family 1 member 5; RD114/simian type D retrovirus receptor; sodium-dependent neutral amino acid transporter type 2; R16; ATBO; M7V1; RDRC; M7VS1; FLJ31068; |
| Gene ID | 6510 |
| mRNA Refseq | NM_001145144 |
| Protein Refseq | NP_001138616 |
| MIM | 109190 |
| UniProt ID | Q15758 |
| Chromosome Location | 19q13.3 |
| Pathway | Amino acid transport across the plasma membrane, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
| Function | L-glutamine transmembrane transporter activity; neutral amino acid transmembrane transporter activity; receptor activity; sodium:dicarboxylate symporter activity; symporter activity; |
| ◆ Recombinant Proteins | ||
| RDRC-2241H | Recombinant Human RDRC protein, GST-tagged | +Inquiry |
| SLC1A5-922C | Recombinant Cynomolgus SLC1A5 Protein, His-tagged | +Inquiry |
| SLC1A5-0913H | Active Recombinant Human SLC1A5 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| SLC1A5-7769Z | Recombinant Zebrafish SLC1A5 | +Inquiry |
| SLC1A5-1210H | Recombinant Human SLC1A5 Protein (A2-F921), 8×His-MBP, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A5 Products
Required fields are marked with *
My Review for All SLC1A5 Products
Required fields are marked with *
