Recombinant Human RDRC protein, GST-tagged

Cat.No. : RDRC-2241H
Product Overview : Recombinant Human RDRC (C-106aa) fussed with GST tag at N-terminal was expressed in E. coli.
Availability September 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : C-106aa
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass : 38 kDa
AA Sequence : VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPL PLPTEEGNPLLKHYRGPAGDATVASEKESVM
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name SLC1A5 solute carrier family 1 (neutral amino acid transporter), member 5 [ Homo sapiens ]
Official Symbol SLC1A5
Synonyms SLC1A5; solute carrier family 1 (neutral amino acid transporter), member 5; M7V1, RDRC; neutral amino acid transporter B(0); AAAT; ASCT2; ATB(0); RD114 virus receptor; baboon M7 virus receptor; neutral amino acid transporter B; solute carrier family 1 member 5; RD114/simian type D retrovirus receptor; sodium-dependent neutral amino acid transporter type 2; R16; ATBO; M7V1; RDRC; M7VS1; FLJ31068;
Gene ID 6510
mRNA Refseq NM_001145144
Protein Refseq NP_001138616
MIM 109190
UniProt ID Q15758
Chromosome Location 19q13.3
Pathway Amino acid transport across the plasma membrane, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function L-glutamine transmembrane transporter activity; neutral amino acid transmembrane transporter activity; receptor activity; sodium:dicarboxylate symporter activity; symporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC1A5 Products

Required fields are marked with *

My Review for All SLC1A5 Products

Required fields are marked with *

0
cart-icon