Recombinant Human REDD1 protein
Cat.No. : | REDD1-2245H |
Product Overview : | Recombinant Human REDD1 (1 - 232 aa) was expressed in E. coli. |
Availability | September 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1 - 232 aa |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
Molecular Mass : | 51 kDa |
AA Sequence : | MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYLDG VSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVC VEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSE QLLIEEC |
Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | DDIT4 DNA-damage-inducible transcript 4 [ Homo sapiens ] |
Official Symbol | DDIT4 |
Synonyms | DDIT4; DNA-damage-inducible transcript 4; DNA damage-inducible transcript 4 protein; Dig2; FLJ20500; HIF 1 responsive RTP801; REDD 1; REDD1; RTP801; HIF-1 responsive protein RTP801; HIF-1 responsive RTP801 (RTP801); protein regulated in development and DNA damage response 1; REDD-1; RP11-442H21.1; |
Gene ID | 54541 |
mRNA Refseq | NM_019058 |
Protein Refseq | NP_061931 |
MIM | 607729 |
UniProt ID | Q9NX09 |
Chromosome Location | 10q22.1 |
Pathway | Direct p53 effectors, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, organism-specific biosystem; mTOR signaling pathway, conserved biosystem; |
Function | 14-3-3 protein binding; |
◆ Recombinant Proteins | ||
Ddit4-2493M | Recombinant Mouse Ddit4 Protein, Myc/DDK-tagged | +Inquiry |
DDIT4-1811R | Recombinant Rat DDIT4 Protein | +Inquiry |
DDIT4-214H | Recombinant Human DDIT4 Protein, MYC/DDK-tagged | +Inquiry |
DDIT4-1032R | Recombinant Rhesus Macaque DDIT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDIT4-2451HF | Recombinant Full Length Human DDIT4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDIT4-7026HCL | Recombinant Human DDIT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDIT4 Products
Required fields are marked with *
My Review for All DDIT4 Products
Required fields are marked with *