Recombinant Human REEP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | REEP2-505H |
| Product Overview : | REEP2 MS Standard C13 and N15-labeled recombinant protein (NP_057690) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 28.3 kDa |
| AA Sequence : | MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | REEP2 receptor accessory protein 2 [ Homo sapiens (human) ] |
| Official Symbol | REEP2 |
| Synonyms | REEP2; receptor accessory protein 2; C5orf19, chromosome 5 open reading frame 19; receptor expression-enhancing protein 2; SGC32445; receptor expression enhancing protein 2; C5orf19; |
| Gene ID | 51308 |
| mRNA Refseq | NM_016606 |
| Protein Refseq | NP_057690 |
| MIM | 609347 |
| UniProt ID | Q9BRK0 |
| ◆ Recombinant Proteins | ||
| REEP2-1667HFL | Recombinant Full Length Human REEP2 Protein, C-Flag-tagged | +Inquiry |
| Reep2-5450M | Recombinant Mouse Reep2 Protein, Myc/DDK-tagged | +Inquiry |
| REEP2-1875H | Recombinant Human REEP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| REEP2-505H | Recombinant Human REEP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL30671MF | Recombinant Full Length Mouse Receptor Expression-Enhancing Protein 2(Reep2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REEP2-2428HCL | Recombinant Human REEP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REEP2 Products
Required fields are marked with *
My Review for All REEP2 Products
Required fields are marked with *
