Recombinant Human REEP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : REEP2-505H
Product Overview : REEP2 MS Standard C13 and N15-labeled recombinant protein (NP_057690) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants.
Molecular Mass : 28.3 kDa
AA Sequence : MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name REEP2 receptor accessory protein 2 [ Homo sapiens (human) ]
Official Symbol REEP2
Synonyms REEP2; receptor accessory protein 2; C5orf19, chromosome 5 open reading frame 19; receptor expression-enhancing protein 2; SGC32445; receptor expression enhancing protein 2; C5orf19;
Gene ID 51308
mRNA Refseq NM_016606
Protein Refseq NP_057690
MIM 609347
UniProt ID Q9BRK0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REEP2 Products

Required fields are marked with *

My Review for All REEP2 Products

Required fields are marked with *

0
cart-icon