Recombinant Human RELA protein, GST-tagged
| Cat.No. : | RELA-3019H |
| Product Overview : | Recombinant Human RELA (1-220 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Gln220 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RELA RELA proto-oncogene, NF-kB subunit [ Homo sapiens (human) ] |
| Official Symbol | RELA |
| Synonyms | RELA; CMCU; NFKB3 |
| Gene ID | 5970 |
| mRNA Refseq | NM_001145138 |
| Protein Refseq | NP_001138610 |
| MIM | 164014 |
| UniProt ID | Q04206 |
| ◆ Recombinant Proteins | ||
| RELA-729H | Recombinant Human RELA Protein, GST-tagged | +Inquiry |
| RELA-333H | Recombinant Human NFκB3 (RELA/p65) Protein, Flag-tagged | +Inquiry |
| Rela-5456M | Recombinant Mouse Rela Protein, Myc/DDK-tagged | +Inquiry |
| Rela-612M | Recombinant Mouse Rela protein, His & T7-tagged | +Inquiry |
| RELA-611H | Recombinant Human RELA protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *
