Recombinant Human RELT Protein, Fc-tagged

Cat.No. : RELT-872H
Product Overview : Recombinant Human RELT, transcript variant 2, fused with Fc tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.
Form : Supplied as a 0.2 µM filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT,10% glycerol, pH 7.4
Molecular Mass : 41.4kD
AA Sequence : STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name RELT RELT tumor necrosis factor receptor [ Homo sapiens ]
Official Symbol RELT
Synonyms RELT; RELT tumor necrosis factor receptor; TNFRSF19L, tumor necrosis factor receptor superfamily, member 19 like; tumor necrosis factor receptor superfamily member 19L; FLJ14993; receptor expressed in lymphoid tissues; TRLT; TNFRSF19L;
Gene ID 84957
mRNA Refseq NM_032871
Protein Refseq NP_116260
MIM 611211
UniProt ID Q969Z4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RELT Products

Required fields are marked with *

My Review for All RELT Products

Required fields are marked with *

0
cart-icon