Recombinant Human RELT Protein, Fc-tagged
Cat.No. : | RELT-872H |
Product Overview : | Recombinant Human RELT, transcript variant 2, fused with Fc tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. |
Form : | Supplied as a 0.2 µM filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT,10% glycerol, pH 7.4 |
Molecular Mass : | 41.4kD |
AA Sequence : | STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | RELT RELT tumor necrosis factor receptor [ Homo sapiens ] |
Official Symbol | RELT |
Synonyms | RELT; RELT tumor necrosis factor receptor; TNFRSF19L, tumor necrosis factor receptor superfamily, member 19 like; tumor necrosis factor receptor superfamily member 19L; FLJ14993; receptor expressed in lymphoid tissues; TRLT; TNFRSF19L; |
Gene ID | 84957 |
mRNA Refseq | NM_032871 |
Protein Refseq | NP_116260 |
MIM | 611211 |
UniProt ID | Q969Z4 |
◆ Recombinant Proteins | ||
RELT-872H | Recombinant Human RELT Protein, Fc-tagged | +Inquiry |
RELT-838H | Recombinant Human RELT protein(Met1-Ala160), His&hFc-tagged | +Inquiry |
RELT-1828R | Recombinant Rhesus Monkey RELT Protein, hIgG4-tagged | +Inquiry |
RELT-1827R | Recombinant Rhesus Monkey RELT Protein, hIgG1-tagged | +Inquiry |
Relt-6790M | Recombinant Mouse Relt Protein (Leu193-Ile436), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELT-2418HCL | Recombinant Human RELT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELT Products
Required fields are marked with *
My Review for All RELT Products
Required fields are marked with *