Recombinant Human RNLS Protein, His tagged
| Cat.No. : | RNLS-7164H |
| Product Overview : | Recombinant Human RNLS Protein (18-342 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-342 aa |
| Description : | Enables several functions, including NADH binding activity; epinephrine binding activity; and monoamine oxidase activity. Involved in negative regulation of blood pressure and negative regulation of heart rate. Located in extracellular region. Implicated in essential hypertension and hypertension. Biomarker of end stage renal disease. |
| Form : | Sterile PBS, pH 7.4, 0.1% SKL |
| Molecular Mass : | 38 kDa |
| AASequence : | MHHHHHHHHHHALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | RNLS renalase, FAD-dependent amine oxidase [ Homo sapiens (human) ] |
| Official Symbol | RNLS |
| Synonyms | RNLS; renalase, FAD-dependent amine oxidase; C10orf59, chromosome 10 open reading frame 59; renalase; FLJ11218; MAO-C; monoamine oxidase-C; C10orf59; RENALASE |
| Gene ID | 55328 |
| mRNA Refseq | NM_001031709 |
| Protein Refseq | NP_001026879 |
| MIM | 609360 |
| UniProt ID | Q5VYX0 |
| ◆ Recombinant Proteins | ||
| Rnls-5561M | Recombinant Mouse Rnls Protein, Myc/DDK-tagged | +Inquiry |
| RNLS-437H | Recombinant Human RNLS Protein, GST-tagged | +Inquiry |
| Rnls-1356M | Recombinant Mouse Rnls Protein, His-SUMO-tagged | +Inquiry |
| RNLS-721Z | Recombinant Zebrafish RNLS | +Inquiry |
| RNLS-8105H | Recombinant Human RNLS protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNLS-2263HCL | Recombinant Human RNLS 293 Cell Lysate | +Inquiry |
| RNLS-2264HCL | Recombinant Human RNLS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNLS Products
Required fields are marked with *
My Review for All RNLS Products
Required fields are marked with *



