Recombinant Human RNLS Protein, GST-tagged
Cat.No. : | RNLS-437H |
Product Overview : | Human C10orf59 full-length ORF ( NP_001026879.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNLS renalase, FAD dependent amine oxidase [ Homo sapiens (human) ] |
Official Symbol | RNLS |
Synonyms | C10orf59; RENALASE |
Gene ID | 55328 |
mRNA Refseq | NM_001031709.1 |
Protein Refseq | NP_001026879.1 |
UniProt ID | Q5VYX0.1 |
◆ Recombinant Proteins | ||
Rnls-1356M | Recombinant Mouse Rnls Protein, His-SUMO-tagged | +Inquiry |
RNLS-6496H | Recombinant Human RNLS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNLS-8105H | Recombinant Human RNLS protein, His & GST-tagged | +Inquiry |
RNLS-5967H | Recombinant Human RNLS Protein (Met1-Ile342), N-SUMO tagged | +Inquiry |
RNLS-437H | Recombinant Human RNLS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNLS-2263HCL | Recombinant Human RNLS 293 Cell Lysate | +Inquiry |
RNLS-2264HCL | Recombinant Human RNLS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNLS Products
Required fields are marked with *
My Review for All RNLS Products
Required fields are marked with *
0
Inquiry Basket