Recombinant Human RERGL Protein, GST-tagged
| Cat.No. : | RERGL-4278H |
| Product Overview : | Human FLJ22655 full-length ORF ( NP_079006.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RERGL (RERG Like) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is RASL11A. |
| Molecular Mass : | 50.3 kDa |
| AA Sequence : | MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RERGL RERG/RAS-like [ Homo sapiens ] |
| Official Symbol | RERGL |
| Synonyms | RERGL; RERG/RAS-like; ras-related and estrogen-regulated growth inhibitor-like protein; FLJ22655; RERG/Ras-like protein; |
| Gene ID | 79785 |
| mRNA Refseq | NM_024730 |
| Protein Refseq | NP_079006 |
| UniProt ID | Q9H628 |
| ◆ Recombinant Proteins | ||
| RERGL-3875H | Recombinant Human RERGL protein, His&Myc-tagged | +Inquiry |
| RERGL-4955HF | Recombinant Full Length Human RERGL Protein, GST-tagged | +Inquiry |
| RERGL-4278H | Recombinant Human RERGL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RERGL-638HCL | Recombinant Human RERGL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RERGL Products
Required fields are marked with *
My Review for All RERGL Products
Required fields are marked with *




