Recombinant Full Length Human RERGL Protein, GST-tagged

Cat.No. : RERGL-4955HF
Product Overview : Human FLJ22655 full-length ORF ( NP_079006.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 205 amino acids
Description : RERGL (RERG Like) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is RASL11A.
Molecular Mass : 50.3 kDa
AA Sequence : MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RERGL RERG/RAS-like [ Homo sapiens ]
Official Symbol RERGL
Synonyms RERGL; RERG/RAS-like; ras-related and estrogen-regulated growth inhibitor-like protein; FLJ22655; RERG/Ras-like protein;
Gene ID 79785
mRNA Refseq NM_024730
Protein Refseq NP_079006
UniProt ID Q9H628

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RERGL Products

Required fields are marked with *

My Review for All RERGL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon