Recombinant Human REST corepressor 1 Protein, His tagged
Cat.No. : | RCOR1-001H |
Product Overview : | Recombinant Human RCOR1 Protein with His tag was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 394-482 aa |
Description : | This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor). |
Tag : | C-His |
Molecular Mass : | 11 kDa |
AA Sequence : | MAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Concentration : | 0.52 mg/mL by BCA |
Gene Name | RCOR1 REST corepressor 1 [ Homo sapiens (human) ] |
Official Symbol | RCOR1 |
Synonyms | RCOR1; REST corepressor 1; RCOR, REST corepressor; COREST; KIAA0071; RCOR |
Gene ID | 23186 |
mRNA Refseq | NM_015156 |
Protein Refseq | NP_055971 |
MIM | 607675 |
UniProt ID | Q9UKL0 |
◆ Recombinant Proteins | ||
RCOR1-301383H | Recombinant Human RCOR1 protein, GST-tagged | +Inquiry |
RCOR1-001H | Recombinant Human REST corepressor 1 Protein, His tagged | +Inquiry |
RCOR1-7502M | Recombinant Mouse RCOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RCOR1-4984Z | Recombinant Zebrafish RCOR1 | +Inquiry |
RCOR1-1852H | Recombinant Human REST Corepressor 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RCOR1 Products
Required fields are marked with *
My Review for All RCOR1 Products
Required fields are marked with *
0
Inquiry Basket