Recombinant Human REST corepressor 1 Protein, His tagged

Cat.No. : RCOR1-001H
Product Overview : Recombinant Human RCOR1 Protein with His tag was expressed in E. coli.
Availability November 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 394-482 aa
Description : This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor).
Tag : C-His
Molecular Mass : 11 kDa
AA Sequence : MAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Concentration : 0.52 mg/mL by BCA
Gene Name RCOR1 REST corepressor 1 [ Homo sapiens (human) ]
Official Symbol RCOR1
Synonyms RCOR1; REST corepressor 1; RCOR, REST corepressor; COREST; KIAA0071; RCOR
Gene ID 23186
mRNA Refseq NM_015156
Protein Refseq NP_055971
MIM 607675
UniProt ID Q9UKL0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCOR1 Products

Required fields are marked with *

My Review for All RCOR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon