Recombinant Human REST corepressor 1 Protein, His tagged

• Cat.No.: RCOR1-001H
• Product Overview: Recombinant Human RCOR1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 394-482 aa
• Description: This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor).
• Tag: C-His
• Molecular Mass: 11 kDa
• AA Sequence: MAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
• Concentration: 0.52 mg/mL by BCA

Gene Information

• Gene Name: RCOR1 REST corepressor 1 [ Homo sapiens (human) ]
• Official Symbol: RCOR1
• Synonyms: RCOR1; REST corepressor 1; RCOR, REST corepressor; COREST; KIAA0071; RCOR
• Gene ID: 23186
• mRNA Refseq: NM_015156
• Protein Refseq: NP_055971
• MIM: 607675
• UniProt ID: Q9UKL0