Recombinant Human RETN protein, His-SUMO-tagged
| Cat.No. : | RETN-3424H |
| Product Overview : | Recombinant Human RETN protein(Q9HD89)(19-108aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 19-108aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.6 kDa |
| AA Sequence : | KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RETN resistin [ Homo sapiens ] |
| Official Symbol | RETN |
| Synonyms | RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609; |
| Gene ID | 56729 |
| mRNA Refseq | NM_001193374 |
| Protein Refseq | NP_001180303 |
| MIM | 605565 |
| UniProt ID | Q9HD89 |
| ◆ Recombinant Proteins | ||
| Retn-1209R | Recombinant Rat Retn Protein, His-tagged | +Inquiry |
| Retn-6791M | Recombinant Mouse Retn Protein (Ser21-Ser114), C-His tagged | +Inquiry |
| RETN-761H | Recombinant Human RETN | +Inquiry |
| RETN-7821P | Recombinant Pig RETN protein, His & T7-tagged | +Inquiry |
| RETN-3981H | Recombinant Human RETN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *
