Recombinant Human RETN protein, His-SUMO-tagged
Cat.No. : | RETN-3424H |
Product Overview : | Recombinant Human RETN protein(Q9HD89)(19-108aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-108aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.6 kDa |
AA Sequence : | KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RETN resistin [ Homo sapiens ] |
Official Symbol | RETN |
Synonyms | RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609; |
Gene ID | 56729 |
mRNA Refseq | NM_001193374 |
Protein Refseq | NP_001180303 |
MIM | 605565 |
UniProt ID | Q9HD89 |
◆ Recombinant Proteins | ||
Retn-1209R | Recombinant Rat Retn Protein, His-tagged | +Inquiry |
RETN-3853R | Recombinant Rhesus monkey RETN Protein, His-tagged | +Inquiry |
RETN-3423B | Recombinant Bovine RETN protein, His-SUMO-tagged | +Inquiry |
RETN-774B | Recombinant Bovine RETN Protein (19-109 aa), His-tagged | +Inquiry |
RETN-18H | Recombinant Human RETN protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *