Recombinant Human RETN Protein, His-tagged

Cat.No. : RETN-012H
Product Overview : Recombinant human Resistin, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Form : Liquid
Molecular Mass : 10.3 kDa
AA Sequence : KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -91 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : 20mM Sodium citrate (pH3.0) containing 20% glycerol
Gene Name RETN resistin [ Homo sapiens (human) ]
Official Symbol RETN
Synonyms RETN; resistin; ADSF; RSTN; XCP1; FIZZ3; RETN1; resistin; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; adipose tissue-specific secretory factor; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; cysteine-rich secreted protein A12-alpha-like 2; cysteine-rich secreted protein FIZZ3; found in inflammatory zone 3; resistin delta2
Gene ID 56729
mRNA Refseq NM_020415
Protein Refseq NP_065148
MIM 605565
UniProt ID Q9HD89

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RETN Products

Required fields are marked with *

My Review for All RETN Products

Required fields are marked with *

0
cart-icon