Recombinant Human RETN Protein, His-tagged
Cat.No. : | RETN-012H |
Product Overview : | Recombinant human Resistin, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 10.3 kDa |
AA Sequence : | KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -91 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | 20mM Sodium citrate (pH3.0) containing 20% glycerol |
Gene Name | RETN resistin [ Homo sapiens (human) ] |
Official Symbol | RETN |
Synonyms | RETN; resistin; ADSF; RSTN; XCP1; FIZZ3; RETN1; resistin; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; adipose tissue-specific secretory factor; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; cysteine-rich secreted protein A12-alpha-like 2; cysteine-rich secreted protein FIZZ3; found in inflammatory zone 3; resistin delta2 |
Gene ID | 56729 |
mRNA Refseq | NM_020415 |
Protein Refseq | NP_065148 |
MIM | 605565 |
UniProt ID | Q9HD89 |
◆ Recombinant Proteins | ||
Retn-5466M | Recombinant Mouse Retn Protein | +Inquiry |
Retn-5477H | Active Recombinant Mouse Retn protein | +Inquiry |
RETN-197H | Recombinant Human RETN protein, hFc-tagged | +Inquiry |
Retn-6791M | Recombinant Mouse Retn Protein (Ser21-Ser114), C-His tagged | +Inquiry |
RETN-7821P | Recombinant Pig RETN protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *
0
Inquiry Basket