Recombinant Human RETN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RETN-6571H |
Product Overview : | RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 11.4 kDa |
AA Sequence : | MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RETN resistin [ Homo sapiens (human) ] |
Official Symbol | RETN |
Synonyms | RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609; |
Gene ID | 56729 |
mRNA Refseq | NM_020415 |
Protein Refseq | NP_065148 |
MIM | 605565 |
UniProt ID | Q9HD89 |
◆ Recombinant Proteins | ||
RETN-1817HFL | Recombinant Full Length Human RETN Protein, C-Flag-tagged | +Inquiry |
Retn-5466M | Recombinant Mouse Retn Protein | +Inquiry |
RETN-6030H | Recombinant Human RETN Protein (Ser17-Pro108), N-His tagged | +Inquiry |
RETN-1882H | Recombinant Human RETN Protein, His (Fc)-Avi-tagged | +Inquiry |
RETN-6027H | Recombinant Human RETN Protein (Lys19-Pro108), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *