Recombinant Human RETN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RETN-6571H
Product Overview : RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 11.4 kDa
AA Sequence : MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RETN resistin [ Homo sapiens (human) ]
Official Symbol RETN
Synonyms RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609;
Gene ID 56729
mRNA Refseq NM_020415
Protein Refseq NP_065148
MIM 605565
UniProt ID Q9HD89

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RETN Products

Required fields are marked with *

My Review for All RETN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon