Recombinant Human RFC5 protein, His-tagged
| Cat.No. : | RFC5-3337H |
| Product Overview : | Recombinant Human RFC5 protein(219-341 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 219-341 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RFC5 replication factor C (activator 1) 5, 36.5kDa [ Homo sapiens ] |
| Official Symbol | RFC5 |
| Synonyms | RFC5; replication factor C (activator 1) 5, 36.5kDa; replication factor C (activator 1) 5 (36.5kD); replication factor C subunit 5; RFC36; A1 36 kDa subunit; RF-C 36 kDa subunit; RFC, 36.5 kD subunit; replication factor C, 36-kDa subunit; MGC1155; |
| Gene ID | 5985 |
| mRNA Refseq | NM_001130112 |
| Protein Refseq | NP_001123584 |
| MIM | 600407 |
| UniProt ID | P40937 |
| ◆ Recombinant Proteins | ||
| RFC5-3337H | Recombinant Human RFC5 protein, His-tagged | +Inquiry |
| RFC5-3676R | Recombinant Rhesus Macaque RFC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Rfc5-1700M | Recombinant Mouse Rfc5 protein, His & T7-tagged | +Inquiry |
| RFC5-1149Z | Recombinant Zebrafish RFC5 | +Inquiry |
| RFC5-01H | Recombinant Human RFC5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RFC5-2409HCL | Recombinant Human RFC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFC5 Products
Required fields are marked with *
My Review for All RFC5 Products
Required fields are marked with *
