Recombinant Human RFPL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RFPL3-3189H
Product Overview : RFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_006595) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : (Microbial infection) Stimulates the activity of Human Immunodeficiency Virus 1/HIV-1 pre-integration complex.
Molecular Mass : 32.2 kDa
AA Sequence : MAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKMKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RFPL3 ret finger protein like 3 [ Homo sapiens (human) ]
Official Symbol RFPL3
Synonyms RFPL3; ret finger protein-like 3; RNF120; ret finger protein-like 3
Gene ID 10738
mRNA Refseq NM_006604
Protein Refseq NP_006595
MIM 605970
UniProt ID O75679

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RFPL3 Products

Required fields are marked with *

My Review for All RFPL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon