Recombinant Human RFPL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RFPL3-3189H |
Product Overview : | RFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_006595) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | (Microbial infection) Stimulates the activity of Human Immunodeficiency Virus 1/HIV-1 pre-integration complex. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKMKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RFPL3 ret finger protein like 3 [ Homo sapiens (human) ] |
Official Symbol | RFPL3 |
Synonyms | RFPL3; ret finger protein-like 3; RNF120; ret finger protein-like 3 |
Gene ID | 10738 |
mRNA Refseq | NM_006604 |
Protein Refseq | NP_006595 |
MIM | 605970 |
UniProt ID | O75679 |
◆ Recombinant Proteins | ||
RFPL3-0002H | Recombinant Human RFPL3 Protein (K2-K317), His tagged | +Inquiry |
RFPL3-0001H | Recombinant Human RFPL3 Protein (K2-K317), Tag Free | +Inquiry |
RFPL3-3189H | Recombinant Human RFPL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFPL3-2261H | Recombinant Human RFPL3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFPL3-2404HCL | Recombinant Human RFPL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFPL3 Products
Required fields are marked with *
My Review for All RFPL3 Products
Required fields are marked with *
0
Inquiry Basket