Recombinant Human RFPL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RFPL3-3189H
• Product Overview: RFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_006595) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: (Microbial infection) Stimulates the activity of Human Immunodeficiency Virus 1/HIV-1 pre-integration complex.
• Molecular Mass: 32.2 kDa
• AA Sequence: MAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKMKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RFPL3 ret finger protein like 3 [ Homo sapiens (human) ]
• Official Symbol: RFPL3
• Synonyms: RFPL3; ret finger protein-like 3; RNF120; ret finger protein-like 3
• Gene ID: 10738
• mRNA Refseq: NM_006604
• Protein Refseq: NP_006595
• MIM: 605970
• UniProt ID: O75679