Recombinant Human RFPL4A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RFPL4A-6332H |
Product Overview : | RFPL4A MS Standard C13 and N15-labeled recombinant protein (NP_001138486) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RFPL4A (Ret Finger Protein Like 4A) is a Protein Coding gene. An important paralog of this gene is RFPL4AL1. |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASAPVSSEGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RFPL4A ret finger protein-like 4A [ Homo sapiens (human) ] |
Official Symbol | RFPL4A |
Synonyms | RFPL4A; ret finger protein-like 4A; ret finger protein like 4, RFPL4; RNF210; RING finger protein 210; ret finger protein-like 4; RFPL4; |
Gene ID | 342931 |
mRNA Refseq | NM_001145014 |
Protein Refseq | NP_001138486 |
MIM | 612601 |
UniProt ID | A6NLU0 |
◆ Recombinant Proteins | ||
RFPL4A-6332H | Recombinant Human RFPL4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFPL4A-4666R | Recombinant Rat RFPL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFPL4A-5007R | Recombinant Rat RFPL4A Protein | +Inquiry |
RFPL4A-1049H | Recombinant Human RFPL4A Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFPL4A Products
Required fields are marked with *
My Review for All RFPL4A Products
Required fields are marked with *