Recombinant Human RFPL4A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RFPL4A-6332H
• Product Overview: RFPL4A MS Standard C13 and N15-labeled recombinant protein (NP_001138486) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RFPL4A (Ret Finger Protein Like 4A) is a Protein Coding gene. An important paralog of this gene is RFPL4AL1.
• Molecular Mass: 32.1 kDa
• AA Sequence: MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASAPVSSEGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RFPL4A ret finger protein-like 4A [ Homo sapiens (human) ]
• Official Symbol: RFPL4A
• Synonyms: RFPL4A; ret finger protein-like 4A; ret finger protein like 4, RFPL4; RNF210; RING finger protein 210; ret finger protein-like 4; RFPL4
• Gene ID: 342931
• mRNA Refseq: NM_001145014
• Protein Refseq: NP_001138486
• MIM: 612601
• UniProt ID: A6NLU0