Recombinant Human RFPL4A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RFPL4A-6332H
Product Overview : RFPL4A MS Standard C13 and N15-labeled recombinant protein (NP_001138486) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RFPL4A (Ret Finger Protein Like 4A) is a Protein Coding gene. An important paralog of this gene is RFPL4AL1.
Molecular Mass : 32.1 kDa
AA Sequence : MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASAPVSSEGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RFPL4A ret finger protein-like 4A [ Homo sapiens (human) ]
Official Symbol RFPL4A
Synonyms RFPL4A; ret finger protein-like 4A; ret finger protein like 4, RFPL4; RNF210; RING finger protein 210; ret finger protein-like 4; RFPL4;
Gene ID 342931
mRNA Refseq NM_001145014
Protein Refseq NP_001138486
MIM 612601
UniProt ID A6NLU0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RFPL4A Products

Required fields are marked with *

My Review for All RFPL4A Products

Required fields are marked with *

0
cart-icon
0
compare icon