Recombinant Human RGMA Protein (169-424 aa), His-MBP-tagged
Cat.No. : | RGMA-2748H |
Product Overview : | Recombinant Human RGMA Protein (169-424 aa) is produced by Baculovirus expression system. This protein is fused with a MBP tag at the N-terminal and a 6xHis tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 169-424 aa |
Description : | Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 72.5 kDa |
AA Sequence : | PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RGMA RGM domain family, member A [ Homo sapiens ] |
Official Symbol | RGMA |
Synonyms | RGMA; RGM domain family, member A; repulsive guidance molecule A; RGM; |
Gene ID | 56963 |
mRNA Refseq | NM_001166283 |
Protein Refseq | NP_001159755 |
MIM | 607362 |
UniProt ID | Q96B86 |
◆ Recombinant Proteins | ||
RGMA-2416H | Recombinant Human RGM Domain Family, Member A, FLAG-tagged | +Inquiry |
Rgma-2417M | Recombinant Mouse RGM Domain Family, Member A, FLAG-tagged | +Inquiry |
RGMA-7560M | Recombinant Mouse RGMA Protein, His (Fc)-Avi-tagged | +Inquiry |
Rgma-5488M | Recombinant Full Length Mouse Rgma Protein, Myc/DDK-tagged | +Inquiry |
RGMA-6035H | Recombinant Human RGMA Protein (Met1-Gly422), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGMA-1697HCL | Recombinant Human RGMA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGMA Products
Required fields are marked with *
My Review for All RGMA Products
Required fields are marked with *
0
Inquiry Basket