Recombinant Human RGP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RGP1-629H |
| Product Overview : | RGP1 MS Standard C13 and N15-labeled recombinant protein (NP_001073965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors. |
| Molecular Mass : | 42.46 kDa |
| AA Sequence : | MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RGP1 RGP1 homolog, RAB6A GEF complex partner 1 [ Homo sapiens (human) ] |
| Official Symbol | RGP1 |
| Synonyms | RGP1; RGP1 homolog, RAB6A GEF complex partner 1; KIAA0258; RAB6A-GEF complex partner protein 2; RGP1 retrograde golgi transport homolog; retrograde Golgi transport protein RGP1 homolog |
| Gene ID | 9827 |
| mRNA Refseq | NM_001080496 |
| Protein Refseq | NP_001073965 |
| MIM | 615742 |
| UniProt ID | Q92546 |
| ◆ Recombinant Proteins | ||
| Rgp1-5489M | Recombinant Mouse Rgp1 Protein, Myc/DDK-tagged | +Inquiry |
| RGP1-3249C | Recombinant Chicken RGP1 | +Inquiry |
| RGP1-3871R | Recombinant Rhesus monkey RGP1 Protein, His-tagged | +Inquiry |
| RGP1-3688R | Recombinant Rhesus Macaque RGP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RGP1-629H | Recombinant Human RGP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RGP1-541HCL | Recombinant Human RGP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGP1 Products
Required fields are marked with *
My Review for All RGP1 Products
Required fields are marked with *
