Recombinant Human RGP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RGP1-629H
Product Overview : RGP1 MS Standard C13 and N15-labeled recombinant protein (NP_001073965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors.
Molecular Mass : 42.46 kDa
AA Sequence : MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RGP1 RGP1 homolog, RAB6A GEF complex partner 1 [ Homo sapiens (human) ]
Official Symbol RGP1
Synonyms RGP1; RGP1 homolog, RAB6A GEF complex partner 1; KIAA0258; RAB6A-GEF complex partner protein 2; RGP1 retrograde golgi transport homolog; retrograde Golgi transport protein RGP1 homolog
Gene ID 9827
mRNA Refseq NM_001080496
Protein Refseq NP_001073965
MIM 615742
UniProt ID Q92546

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RGP1 Products

Required fields are marked with *

My Review for All RGP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon