Recombinant Human RGS10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RGS10-4835H |
Product Overview : | RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_002916) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | MEHIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RGS10 regulator of G-protein signaling 10 [ Homo sapiens (human) ] |
Official Symbol | RGS10 |
Synonyms | RGS10; regulator of G-protein signaling 10; regulator of G protein signalling 10; regulator of G-protein signalling 10; |
Gene ID | 6001 |
mRNA Refseq | NM_002925 |
Protein Refseq | NP_002916 |
MIM | 602856 |
UniProt ID | O43665 |
◆ Recombinant Proteins | ||
RGS10-2274H | Recombinant Human RGS10, GST-tagged | +Inquiry |
RGS10-30741TH | Recombinant Human RGS10, His-tagged | +Inquiry |
Rgs10-5490M | Recombinant Mouse Rgs10 Protein, Myc/DDK-tagged | +Inquiry |
RGS10-4835H | Recombinant Human RGS10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RGS10-2356H | Recombinant Human RGS10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS10-2386HCL | Recombinant Human RGS10 293 Cell Lysate | +Inquiry |
RGS10-2385HCL | Recombinant Human RGS10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS10 Products
Required fields are marked with *
My Review for All RGS10 Products
Required fields are marked with *
0
Inquiry Basket