Recombinant Human RGS20 protein, GST-tagged

• Cat.No.: RGS20-3428H
• Product Overview: Recombinant Human RGS20 protein(O76081)(1-234aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-234aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.4 kDa
• AA Sequence: EPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RGS20 regulator of G-protein signaling 20 [ Homo sapiens ]
• Official Symbol: RGS20
• Synonyms: RGS20; regulator of G-protein signaling 20; regulator of G protein signalling 20; RGSZ1; ZGAP1; gz-GAP; g(z)GAP; regulator of G-protein signaling Z1; regulator of G-protein signalling 20; gz-selective GTPase-activating protein; regulator of G-protein signaling 20 variant 2; regulator of Gz-selective protein signaling 1
• Gene ID: 8601
• mRNA Refseq: NM_003702
• Protein Refseq: NP_003693
• MIM: 607193
• UniProt ID: O76081