Recombinant Human RGS4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RGS4-1188H
• Product Overview: RGS4 MS Standard C13 and N15-labeled recombinant protein (NP_005604) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 23.3 kDa
• AA Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RGS4 regulator of G-protein signaling 4 [ Homo sapiens (human) ]
• Official Symbol: RGS4
• Synonyms: RGS4; regulator of G-protein signaling 4; regulator of G protein signalling 4, schizophrenia disorder 9, SCZD9; schizophrenia disorder 9; RGP4; SCZD9; MGC2124; MGC60244; DKFZp761F1924
• Gene ID: 5999
• mRNA Refseq: NM_005613
• Protein Refseq: NP_005604
• MIM: 602516
• UniProt ID: P49798