Recombinant Human RHD protein(388-417aa), MBP&His-Avi-tagged, Biotinylated
| Cat.No. : | RHD-3010H |
| Product Overview : | Biotinylated Recombinant Human RHD protein(Q02161)(388-417aa), fused with N-terminal MBP and C-terminal His and Avi tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His&MBP |
| Protein Length : | 388-417aa |
| Conjugation/Label : | Biotin |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF |
| Conjugation : | Biotin |
| Gene Name | RHD Rh blood group, D antigen [ Homo sapiens ] |
| Official Symbol | RHD |
| Synonyms | RHD; Rh blood group, D antigen; RH, Rhesus blood group, D antigen; blood group Rh(D) polypeptide; CD240D; DIIIc; Rh4; Rh30a; RhII; RhPI; D antigen (DCS); RH polypeptide 2; rhesus D antigen; Rhesus system D polypeptide; Rh blood group antigen Evans; Rhesus blood group D antigen allele DIII type 7; RH; RH30; RHCED; RHDel; RHPII; RhDCw; RHXIII; RHDVA(TT); RhK562-II; MGC165007; |
| Gene ID | 6007 |
| mRNA Refseq | NM_001127691 |
| Protein Refseq | NP_001121163 |
| MIM | 111680 |
| UniProt ID | Q02161 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHD Products
Required fields are marked with *
My Review for All RHD Products
Required fields are marked with *




