Recombinant Human RHD protein, His-GST-tagged
Cat.No. : | RHD-3430H |
Product Overview : | Recombinant Human RHD protein(Q02161)(388-417aa), fused to N-terminal His-GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His-GST |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.6 kDa |
Protein length : | 388-417aa |
AA Sequence : | LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name : | RHD Rh blood group, D antigen [ Homo sapiens ] |
Official Symbol : | RHD |
Synonyms : | RHD; Rh blood group, D antigen; RH, Rhesus blood group, D antigen; blood group Rh(D) polypeptide; CD240D; DIIIc; Rh4; Rh30a; RhII; RhPI; D antigen (DCS); RH polypeptide 2; rhesus D antigen; Rhesus system D polypeptide; Rh blood group antigen Evans; Rhesus blood group D antigen allele DIII type 7; RH; RH30; RHCED; RHDel; RHPII; RhDCw; RHXIII; RHDVA(TT); RhK562-II; MGC165007; |
Gene ID : | 6007 |
mRNA Refseq : | NM_001127691 |
Protein Refseq : | NP_001121163 |
MIM : | 111680 |
UniProt ID : | Q02161 |
Products Types
◆ Recombinant Protein | ||
RHD-26H | Recombinant Human RHD Protein, His-GST-tagged | +Inquiry |
RHD-7581M | Recombinant Mouse RHD Protein, His (Fc)-Avi-tagged | +Inquiry |
RHD-4690R | Recombinant Rat RHD Protein, His (Fc)-Avi-tagged | +Inquiry |
RHD-32HCL | Recombinant Human RHD Cell Lysate | +Inquiry |
RHD-5031R | Recombinant Rat RHD Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket