Recombinant Human RHD protein, His-GST-tagged

Cat.No. : RHD-3430H
Product Overview : Recombinant Human RHD protein(Q02161)(388-417aa), fused to N-terminal His-GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 388-417aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.6 kDa
AA Sequence : LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name RHD Rh blood group, D antigen [ Homo sapiens ]
Official Symbol RHD
Synonyms RHD; Rh blood group, D antigen; RH, Rhesus blood group, D antigen; blood group Rh(D) polypeptide; CD240D; DIIIc; Rh4; Rh30a; RhII; RhPI; D antigen (DCS); RH polypeptide 2; rhesus D antigen; Rhesus system D polypeptide; Rh blood group antigen Evans; Rhesus blood group D antigen allele DIII type 7; RH; RH30; RHCED; RHDel; RHPII; RhDCw; RHXIII; RHDVA(TT); RhK562-II; MGC165007;
Gene ID 6007
mRNA Refseq NM_001127691
Protein Refseq NP_001121163
MIM 111680
UniProt ID Q02161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHD Products

Required fields are marked with *

My Review for All RHD Products

Required fields are marked with *

0
cart-icon