Recombinant Human RHD protein, His-GST-tagged
Cat.No. : | RHD-3430H |
Product Overview : | Recombinant Human RHD protein(Q02161)(388-417aa), fused to N-terminal His-GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 388-417aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RHD Rh blood group, D antigen [ Homo sapiens ] |
Official Symbol | RHD |
Synonyms | RHD; Rh blood group, D antigen; RH, Rhesus blood group, D antigen; blood group Rh(D) polypeptide; CD240D; DIIIc; Rh4; Rh30a; RhII; RhPI; D antigen (DCS); RH polypeptide 2; rhesus D antigen; Rhesus system D polypeptide; Rh blood group antigen Evans; Rhesus blood group D antigen allele DIII type 7; RH; RH30; RHCED; RHDel; RHPII; RhDCw; RHXIII; RHDVA(TT); RhK562-II; MGC165007; |
Gene ID | 6007 |
mRNA Refseq | NM_001127691 |
Protein Refseq | NP_001121163 |
MIM | 111680 |
UniProt ID | Q02161 |
◆ Recombinant Proteins | ||
RHD-4690R | Recombinant Rat RHD Protein, His (Fc)-Avi-tagged | +Inquiry |
RHD-6178H | Recombinant Human RHD Protein (Ser2-Gly87), N-GST tagged | +Inquiry |
RHD-023H | Recombinant Human RHD Full Length Transmembrane protein, His-tagged | +Inquiry |
RHD-2392H | Recombinant Human RHD Full Length Transmembrane protein, His-tagged | +Inquiry |
RHD-5031R | Recombinant Rat RHD Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHD Products
Required fields are marked with *
My Review for All RHD Products
Required fields are marked with *