Recombinant Human RHD protein, His-GST-tagged

• Cat.No.: RHD-3430H
• Product Overview: Recombinant Human RHD protein(Q02161)(388-417aa), fused to N-terminal His-GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 388-417aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.6 kDa
• AA Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RHD Rh blood group, D antigen [ Homo sapiens ]
• Official Symbol: RHD
• Synonyms: RHD; Rh blood group, D antigen; RH, Rhesus blood group, D antigen; blood group Rh(D) polypeptide; CD240D; DIIIc; Rh4; Rh30a; RhII; RhPI; D antigen (DCS); RH polypeptide 2; rhesus D antigen; Rhesus system D polypeptide; Rh blood group antigen Evans; Rhesus blood group D antigen allele DIII type 7; RH; RH30; RHCED; RHDel; RHPII; RhDCw; RHXIII; RHDVA(TT); RhK562-II; MGC165007
• Gene ID: 6007
• mRNA Refseq: NM_001127691
• Protein Refseq: NP_001121163
• MIM: 111680
• UniProt ID: Q02161