Recombinant Human RHOB protein, His-tagged
| Cat.No. : | RHOB-2121H |
| Product Overview : | Recombinant Human RHOB protein(1-196 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-196 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RHOB ras homolog family member B [ Homo sapiens ] |
| Official Symbol | RHOB |
| Synonyms | RHOB; ras homolog family member B; ARH6, ARHB, ras homolog gene family, member B; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; h6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B; ARH6; ARHB; MSTP081; |
| mRNA Refseq | NM_004040 |
| Protein Refseq | NP_004031 |
| MIM | 165370 |
| UniProt ID | P62745 |
| Gene ID | 388 |
| ◆ Recombinant Proteins | ||
| RHOB-601C | Recombinant Cynomolgus Monkey RHOB Protein, His (Fc)-Avi-tagged | +Inquiry |
| RHOB-3529H | Recombinant Human Ras Homolog Gene Family, Member B, His-tagged | +Inquiry |
| RHOB-2291H | Recombinant Human RHOB protein, GST-tagged | +Inquiry |
| RHOB-858C | Recombinant Cynomolgus RHOB Protein, His-tagged | +Inquiry |
| RHOB-5860H | Recombinant Human RHOB Protein (Val48-Leu196), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RHOB-2356HCL | Recombinant Human RHOB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOB Products
Required fields are marked with *
My Review for All RHOB Products
Required fields are marked with *
