Recombinant Human RHOD protein, His&Myc-tagged
| Cat.No. : | RHOD-4518H |
| Product Overview : | Recombinant Human RHOD protein(O00212)(1-207aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-207aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.6 kDa |
| AA Sequence : | MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | RHOD ras homolog family member D [ Homo sapiens ] |
| Official Symbol | RHOD |
| Synonyms | RHOD; ras homolog family member D; ARHD, ras homolog gene family, member D; rho-related GTP-binding protein RhoD; Rho; Rho related GTP binding protein RhoD; Rho related protein HP1; RhoD; RhoHP1; ras homolog D; Rho-related protein HP1; ras homolog gene family, member A; ras homolog gene family, member D; ARHD; RHOM; RHOHP1; |
| Gene ID | 29984 |
| mRNA Refseq | NM_014578 |
| Protein Refseq | NP_055393 |
| MIM | 605781 |
| UniProt ID | O00212 |
| ◆ Recombinant Proteins | ||
| RHOD-2293H | Recombinant Human RHOD, His-tagged | +Inquiry |
| RHOD-7589M | Recombinant Mouse RHOD Protein, His (Fc)-Avi-tagged | +Inquiry |
| RHOD-14173M | Recombinant Mouse RHOD Protein | +Inquiry |
| Rhod-644M | Recombinant Mouse Rhod Protein, MYC/DDK-tagged | +Inquiry |
| RHOD-30391TH | Recombinant Human RHOD, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RHOD-2350HCL | Recombinant Human RHOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOD Products
Required fields are marked with *
My Review for All RHOD Products
Required fields are marked with *



