Recombinant Human RHOD protein, His&Myc-tagged
Cat.No. : | RHOD-4518H |
Product Overview : | Recombinant Human RHOD protein(O00212)(1-207aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-207aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.6 kDa |
AA Sequence : | MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | RHOD ras homolog family member D [ Homo sapiens ] |
Official Symbol | RHOD |
Synonyms | RHOD; ras homolog family member D; ARHD, ras homolog gene family, member D; rho-related GTP-binding protein RhoD; Rho; Rho related GTP binding protein RhoD; Rho related protein HP1; RhoD; RhoHP1; ras homolog D; Rho-related protein HP1; ras homolog gene family, member A; ras homolog gene family, member D; ARHD; RHOM; RHOHP1; |
Gene ID | 29984 |
mRNA Refseq | NM_014578 |
Protein Refseq | NP_055393 |
MIM | 605781 |
UniProt ID | O00212 |
◆ Recombinant Proteins | ||
RHOD-2293H | Recombinant Human RHOD, His-tagged | +Inquiry |
RHOD-4518H | Recombinant Human RHOD protein, His&Myc-tagged | +Inquiry |
RHOD-1868H | Recombinant Human RHOD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RHOD-28246TH | Recombinant Human RHOD, His-tagged | +Inquiry |
RHOD-14173M | Recombinant Mouse RHOD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOD-2350HCL | Recombinant Human RHOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOD Products
Required fields are marked with *
My Review for All RHOD Products
Required fields are marked with *
0
Inquiry Basket