Recombinant Human RHOF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RHOF-1372H |
Product Overview : | RHOF MS Standard C13 and N15-labeled recombinant protein (NP_061907) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RHOF ras homolog family member F, filopodia associated [ Homo sapiens (human) ] |
Official Symbol | RHOF |
Synonyms | RHOF; ras homolog family member F (in filopodia); ARHF, ras homolog gene family, member F (in filopodia); rho-related GTP-binding protein RhoF; FLJ20247; RIF; rho in filopodia; rho family GTPase Rif; ras homolog gene family, member F (in filopodia); ARHF; |
Gene ID | 54509 |
mRNA Refseq | NM_019034 |
Protein Refseq | NP_061907 |
MIM | 618867 |
UniProt ID | Q9HBH0 |
◆ Recombinant Proteins | ||
RHOF-1372H | Recombinant Human RHOF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RHOF-1180H | Recombinant Human RHOF Protein, MYC/DDK-tagged | +Inquiry |
RHOF-2815Z | Recombinant Zebrafish RHOF | +Inquiry |
RHOF-5401C | Recombinant Chicken RHOF | +Inquiry |
Rhof-5506M | Recombinant Mouse Rhof Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOF-1505HCL | Recombinant Human RHOF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOF Products
Required fields are marked with *
My Review for All RHOF Products
Required fields are marked with *