Recombinant Human RHOF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RHOF-1372H
• Product Overview: RHOF MS Standard C13 and N15-labeled recombinant protein (NP_061907) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.
• Molecular Mass: 23.4 kDa
• AA Sequence: MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RHOF ras homolog family member F, filopodia associated [ Homo sapiens (human) ]
• Official Symbol: RHOF
• Synonyms: RHOF; ras homolog family member F (in filopodia); ARHF, ras homolog gene family, member F (in filopodia); rho-related GTP-binding protein RhoF; FLJ20247; RIF; rho in filopodia; rho family GTPase Rif; ras homolog gene family, member F (in filopodia); ARHF
• Gene ID: 54509
• mRNA Refseq: NM_019034
• Protein Refseq: NP_061907
• MIM: 618867
• UniProt ID: Q9HBH0