Recombinant Human RHOH protein, His-tagged
| Cat.No. : | RHOH-3513H |
| Product Overview : | Recombinant Human RHOH protein(1-191 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-191 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RHOH ras homolog family member H [ Homo sapiens ] |
| Official Symbol | RHOH |
| Synonyms | RHOH; ras homolog family member H; ARHH, ras homolog gene family, member H; rho-related GTP-binding protein RhoH; RhoH; TTF; GTP-binding protein TTF; TTF, translocation three four; translocation three four protein; ras homolog gene family, member H; ARHH; |
| Gene ID | 399 |
| mRNA Refseq | NM_004310 |
| Protein Refseq | NP_004301 |
| MIM | 602037 |
| UniProt ID | Q15669 |
| ◆ Recombinant Proteins | ||
| RHOH-2294H | Recombinant Human RHOH, GST-tagged | +Inquiry |
| RHOH-3889R | Recombinant Rhesus monkey RHOH Protein, His-tagged | +Inquiry |
| RHOH-3513H | Recombinant Human RHOH protein, His-tagged | +Inquiry |
| RHOH-3706R | Recombinant Rhesus Macaque RHOH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RHOH-2349HCL | Recombinant Human RHOH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOH Products
Required fields are marked with *
My Review for All RHOH Products
Required fields are marked with *
