Recombinant Human RHOJ Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RHOJ-4525H |
Product Overview : | RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSIITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RHOJ ras homolog family member J [ Homo sapiens (human) ] |
Official Symbol | RHOJ |
Synonyms | RHOJ; ras homolog family member J; ARHJ, ras homolog gene family, member J, RAS like, family 7, member B, RASL7B; rho-related GTP-binding protein RhoJ; FLJ14445; TCL; TC10-like Rho GTPase; RAS-like, family 7, member B; tc10-like GTP-binding protein; ras homolog gene family, member J; ras-like protein family member 7B; ARHJ; TC10B; RASL7B; MGC34777; |
Gene ID | 57381 |
mRNA Refseq | NM_020663 |
Protein Refseq | NP_065714 |
MIM | 607653 |
UniProt ID | Q9H4E5 |
◆ Recombinant Proteins | ||
RHOJ-4934C | Recombinant Chicken RHOJ | +Inquiry |
RHOJ-3939Z | Recombinant Zebrafish RHOJ | +Inquiry |
RHOJ-3707R | Recombinant Rhesus Macaque RHOJ Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOJ-7591M | Recombinant Mouse RHOJ Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOJ-4525H | Recombinant Human RHOJ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOJ-2348HCL | Recombinant Human RHOJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOJ Products
Required fields are marked with *
My Review for All RHOJ Products
Required fields are marked with *