Recombinant Human RHOT2, His-tagged
Cat.No. : | RHOT2-30983TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-226 of Human RHOT2 with N terminal His tag; MWt 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-226 a.a. |
Description : | Mitochondrial GTPase involved in mitochondrial trafficking. RHOT2 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution. There are two isoforms. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEI TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVV CVVYDVSEEATIEKIRTKWIPLVNGGTTQGPRVPIILV GNKSDLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRN ISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQAL |
Gene Name | RHOT2 ras homolog gene family, member T2 [ Homo sapiens ] |
Official Symbol | RHOT2 |
Synonyms | RHOT2; ras homolog gene family, member T2; ARHT2, C16orf39, chromosome 16 open reading frame 39; mitochondrial Rho GTPase 2; MIRO 2; |
Gene ID | 89941 |
mRNA Refseq | NM_138769 |
Protein Refseq | NP_620124 |
MIM | 613889 |
Uniprot ID | Q8IXI1 |
Chromosome Location | 16p13.3 |
Pathway | Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
Function | GTP binding; GTPase activity; calcium ion binding; hydrolase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
RHOT2-1890H | Recombinant Human RHOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOT2-14179M | Recombinant Mouse RHOT2 Protein | +Inquiry |
RHOT2-5038R | Recombinant Rat RHOT2 Protein | +Inquiry |
RHOT2-1423HFL | Recombinant Full Length Human RHOT2 Protein, C-Flag-tagged | +Inquiry |
RHOT2-1176H | Recombinant Human RHOT2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOT2-1507HCL | Recombinant Human RHOT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOT2 Products
Required fields are marked with *
My Review for All RHOT2 Products
Required fields are marked with *
0
Inquiry Basket