Recombinant Human RHOT2 protein, His-tagged
Cat.No. : | RHOT2-3866H |
Product Overview : | Recombinant Human RHOT2 protein(319-618 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 319-618 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RHOT2 ras homolog family member T2 [ Homo sapiens ] |
Official Symbol | RHOT2 |
Synonyms | RHOT2; ras homolog family member T2; ARHT2, C16orf39, chromosome 16 open reading frame 39 , ras homolog gene family, member T2; mitochondrial Rho GTPase 2; MIRO 2; mitochondrial Rho (MIRO) GTPase 2; ras homolog gene family, member T2; RASL; ARHT2; MIRO2; MIRO-2; C16orf39; |
Gene ID | 89941 |
mRNA Refseq | NM_138769 |
Protein Refseq | NP_620124 |
MIM | 613889 |
UniProt ID | Q8IXI1 |
◆ Recombinant Proteins | ||
RHOT2-3623C | Recombinant Chicken RHOT2 | +Inquiry |
Rhot2-5507M | Recombinant Mouse Rhot2 Protein, Myc/DDK-tagged | +Inquiry |
RHOT2-1176H | Recombinant Human RHOT2 Protein, MYC/DDK-tagged | +Inquiry |
RHOT2-5038R | Recombinant Rat RHOT2 Protein | +Inquiry |
RHOT2-14179M | Recombinant Mouse RHOT2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOT2-1507HCL | Recombinant Human RHOT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOT2 Products
Required fields are marked with *
My Review for All RHOT2 Products
Required fields are marked with *
0
Inquiry Basket