Recombinant Human RHOXF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RHOXF2-3948H
Product Overview : RHOXF2 MS Standard C13 and N15-labeled recombinant protein (NP_115887) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene, which encodes a transcriptional repressor, is one of two paralogous X-linked homeobox-containing genes and is highly expressed in a variety of cancers. In addition, the encoded protein associates with the cell membrane and with microtubules, and is concentrated at the leading edge of migratory cells.
Molecular Mass : 31.7 kDa
AA Sequence : MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RHOXF2 Rhox homeobox family member 2 [ Homo sapiens (human) ]
Official Symbol RHOXF2
Synonyms RHOXF2; Rhox homeobox family, member 2; rhox homeobox family member 2; cancer/testis antigen 107; CT107; PEPP 2; PEPP2; THG1; PEPP subfamily gene 2; testis homeobox gene 1; homeobox protein from AL590526; paired-like homeobox protein PEPP-2; PEPP-2;
Gene ID 84528
mRNA Refseq NM_032498
Protein Refseq NP_115887
MIM 300447
UniProt ID Q9BQY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOXF2 Products

Required fields are marked with *

My Review for All RHOXF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon