Recombinant Human RHOXF2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RHOXF2-3948H |
Product Overview : | RHOXF2 MS Standard C13 and N15-labeled recombinant protein (NP_115887) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene, which encodes a transcriptional repressor, is one of two paralogous X-linked homeobox-containing genes and is highly expressed in a variety of cancers. In addition, the encoded protein associates with the cell membrane and with microtubules, and is concentrated at the leading edge of migratory cells. |
Molecular Mass : | 31.7 kDa |
AA Sequence : | MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RHOXF2 Rhox homeobox family member 2 [ Homo sapiens (human) ] |
Official Symbol | RHOXF2 |
Synonyms | RHOXF2; Rhox homeobox family, member 2; rhox homeobox family member 2; cancer/testis antigen 107; CT107; PEPP 2; PEPP2; THG1; PEPP subfamily gene 2; testis homeobox gene 1; homeobox protein from AL590526; paired-like homeobox protein PEPP-2; PEPP-2; |
Gene ID | 84528 |
mRNA Refseq | NM_032498 |
Protein Refseq | NP_115887 |
MIM | 300447 |
UniProt ID | Q9BQY4 |
◆ Recombinant Proteins | ||
RHOXF2-3948H | Recombinant Human RHOXF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOXF2-2345HCL | Recombinant Human RHOXF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOXF2 Products
Required fields are marked with *
My Review for All RHOXF2 Products
Required fields are marked with *
0
Inquiry Basket