Recombinant Human RIPK3 protein, GST-tagged
| Cat.No. : | RIPK3-9966H |
| Product Overview : | Recombinant Human RIPK3 protein(132-202 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 132-202 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | HDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTAS |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RIPK3 receptor-interacting serine-threonine kinase 3 [ Homo sapiens ] |
| Official Symbol | RIPK3 |
| Synonyms | RIPK3; receptor-interacting serine-threonine kinase 3; receptor-interacting serine/threonine-protein kinase 3; RIP3; RIP-3; RIP-like protein kinase 3; receptor interacting protein 3; receptor-interacting protein 3; |
| mRNA Refseq | NM_006871 |
| Protein Refseq | NP_006862 |
| MIM | 605817 |
| UniProt ID | Q9Y572 |
| Gene ID | 11035 |
| ◆ Recombinant Proteins | ||
| RIPK3-4978H | Recombinant Human RIPK3 protein, His-SUMO-tagged | +Inquiry |
| RIPK3-894H | Recombinant Human RIPK3 Protein, GST-tagged | +Inquiry |
| RIPK3-29985TH | Recombinant Human RIPK3 | +Inquiry |
| RIPK3-9966H | Recombinant Human RIPK3 protein, GST-tagged | +Inquiry |
| RIPK3-2348H | Recombinant Full Length Human RIPK3 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RIPK3-2332HCL | Recombinant Human RIPK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIPK3 Products
Required fields are marked with *
My Review for All RIPK3 Products
Required fields are marked with *



